>5zju_q mol:protein length:209  Capsid protein
MGSSHHHHHHSSGLVPRGSHFNTRLSRTFGYTIKRTTVKTPSWAVDMMRFNINDFLPPG
GGSNPRSVPFEYYRIRKVKVEFWPCSPITQGDRGVGSSAVILDDNFVTKATALTYDPYV
NYSSRHTITQPFSYHSRYFTPKPVLDSTIDYFQPNNKRNQLWLRLQTAGNVDHVGLGTA
FENSIYDQEYNIRVTMYVQFREFNLKDPPLNP