>5zx2_B mol:protein length:368  DNA-directed RNA polymerase subunit alpha
MGHHHHHHHHHHSSGHIEGRHMLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSL
RRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNLKSLVVSSEEDEPVTMYL
RKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASG
AEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTL
VELFGLARELNVEAEGIEIGPSPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGE
LVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEVAGYDVATGTWSTE
GAYDEQDYAETEQL