>6a08_A mol:protein length:377  4-hydroxymandelate oxidase
MGSSHHHHHHSSGLVPRGSHMTYVSLADLERAARDVLPGEIFDFLAGGSGTEASLVANR
TALERVFVIPRMLRDLTDVTTEIDIFGRRAALPMAVAPVAYQRLFHPEGELAVARAARD
AGVPYTICTLSSVSLEEIAAVGGRPWFQLYWLRDEKRSLDLVRRAEDAGCEAIVFTVDV
PWMGRRLRDMRNGFALPEWVTAANFDAGTAAHRRTQGVSAVADHTAREFAPATWESVEA
VRAHTDLPVVLKGILAVEDARRAVDAGAGGIVVSNHGGRQLDGAVPGIEMLGEIVAAVS
GGCEVLVDGGIRSGGDVLKATALGASAVLVGRPVMWALAAAGQDGVRQLLELLAEEVRD
AMGLAGCESVGAARRLNTKLGVV