>6a5t_L mol:protein length:72  RNA polymerase subunit ABC10-alpha
MSREGFVAPSGTDLAAAASGVAPNKHYGVKYTCGACAHNFSLNKSDPVRCKECGHRVIY
KARTKRMIQFDAR