>6acq_E mol:protein length:302  3-hydroxybutyryl-CoA dehydrogenase
MGSSHHHHHHSSGLVPRGSHMKKVCVIGAGTMGSGIAQAFAAKGFEVVLRDIKDEFVDR
GLDFINKNLSKLVKKGKIEEATKVEILTRISGTVDLNMAADCDLVIEAAVERMDIKKQI
FADLDNICKPETILASNTSSLSITEVASATKRPDKVIGMHFFNPAPVMKLVEVIRGIAT
SQETFDAVKETSIAIGKDPVEVAEAPGFVVNRILIPMINEAVGILAEGIASVEDIDKAM
KLGANHPMGPLELGDFIGLDICLAIMDVLYSETGDSKYRPHTLLKKYVRAGWLGRKSGK
GFYDYSK