>6ah0_S mol:protein length:76  Small nuclear ribonucleoprotein G
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGM
VVIRGNSIIMLEALERV