>6ah0_e mol:protein length:126  Small nuclear ribonucleoprotein Sm D3
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLE
QVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGR
GNIFQKRR