>6ah0_p mol:protein length:225  U2 small nuclear ribonucleoprotein B''
MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKEL
GSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTAT
TTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGF
KEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK