>6ah0_t mol:protein length:91  U6 snRNA-associated Sm-like protein LSm5
MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEI
TPEGRRITKLDQILLNGNNITMLVPGGEGPEV