>6ah0_z mol:protein length:96  U6 snRNA-associated Sm-like protein LSm8
MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGL
YIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH