>6ahu_D mol:protein length:220  Ribonuclease P protein subunit p29
MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFLKRSTPRMSPQAREDQLQRKAVVLE
YFTRHKRKEKKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLK
PDTQPQMIQAKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVI
PKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL