>6ath_C mol:protein length:68  Cyclin-dependent kinase inhibitor 1B
GSHMEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEW
QEVEKGSLP