>6b3i_B mol:protein length:343  Annexin
MSYYHHHHHHDYDIPTTENLYFQGAMEMGNRHAKASSPQGFDVDRDAKKLNKACKGMGT
NEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTALALLDHPSEYA
ARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLKK
ILVSLLQANRNEGDDVDKDLAGQDAKDLYDAGEGRWGTDELAFNEVLAKRSYKQLRATF
QAYQILIGKDIEEAIEEETSGDLQKAYLTLVRCAQDCEDYFAERLYKSMKGAGTDEETL
IRIIVTRAEVDLQGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALLH