>6bch_A mol:protein length:315  Ribosomal protein 3/homing endonuclease-like fusion protein
SYSTLANFPVQARNDNISPWTITGFADADSSFMLTVSKDSKRNTGWSVRPRFRIGLHNK
DVTILKSIREYLGAGIITSDIDARIRFESLKELEVVINHFDKYPLITQKRADYLLFKKA
FYLIKNKEHLTEEGLNQILTLKASLNLGLSEELKEAFPNTIPAERLLVTGQEIPDSNWV
AGFTAGEGSFYIRIAKNSTLKTGYQVQSVFQITQDTRDIELMKNLISYLNCGNIRIRKY
KGSEGIHDTCVDLVVTNLNDIKEKIIPFFNKNHIIGVKLQDYRDWCKVVTLIDNKEHLT
SEGLEKIQKIKEGMNRGRSL