>6bgh_A mol:protein length:87  Bromodomain-containing protein 3
ASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIE
IDFETLKPTTLRELERYVKSCLQKKQRK