>6bsf_A mol:protein length:91  Glucocorticoid receptor
GSHMKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNC
PACRYRKCLQAGMNLEARKTKKKIKGIQQATT