>6bsf_B mol:protein length:91  Glucocorticoid receptor
GSHMKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNC
PACRYRKCLQAGMNLEARKTKKKIKGIQQATT