>6c1u_F mol:protein length:79  Methyl-CpG-binding domain protein 2
GATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT
VDLSSFDFRTGKMMPSKLQK