>6cnb_J mol:protein length:70  DNA-directed RNA polymerases I, II, and III subunit RPABC5
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEK
FLRYNPLEKRD