>6cq7_A mol:protein length:80  Mitogen-activated protein kinase kinase kinase 11, Huntingtin fusion protein
GSHMYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIF
PSNYVSRGGGPPPPGPAVAEE