>6csu_B mol:protein length:54  Centrosomal protein of 152 kDa
MGALEELRGQYIKAVKKIKCDMLRYIQESKERAAEMVKAEVLRERQETARKMRK