>6cus_A mol:protein length:87  Matrix protein p19
SEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALS
QRAMILGKSGELKTWGLVLGALKAAREE