>6d6q_L mol:protein length:162  M-phase phosphoprotein 6
DPMAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESF
IIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMAR
RYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD