>6dc0_B mol:protein length:292  Tribbles homolog 1,CCAAT/enhancer-binding protein alpha
SAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSN
ITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAI
VLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTY
SGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLL
RREPSERLTAPEILLHPWFESVLEGSGSSGGPGGGICEHETSIDISAYIDPAAFND