>6dv9_A mol:protein length:359  DNA-directed RNA polymerase subunit alpha
MGHHHHHHHHHHMLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIP
GAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNLKSLVVSSEEDEPVTMYLRKQGPGEVT
AGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIGRIPVD
SIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARE
LNVEAEGIEIGPSPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDL
LDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEVAGYDVATGTWSTEGAYDEQDYA
ETEQL