>6dwy_A mol:protein length:517  Hermes transposase
GSHMSRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGEH
VNVEELLPSPITLSRKVTSDAKEKKALISREIKSAVEKDGASATIDLWTDNYIKRNFLG
VTLHYHENNELRDLILGLKSLDFERSTAENIYKKLKAIFSQFNVEDLSSIKFVTDRGAN
VVKSLANNIRINCSSHLLSNVLENSFEETPELNMPILACKNIVKYFKKANLQHRLRSSL
KSECPTRWNSTYTMLRSILDNWESVIQILSEAGETQRIVHINKSIIQTMVNILDGFERI
FKELQTCSSPSLCFVVPSILKVKEICSPDVGDVADIAKLKVNIIKNVRIIWEENLSIWH
YTAFFFYPPALHMQQEKVAQIKEFCLSKMEDLELINRMSSFNELSATQLNQSDSNSHNS
IDLTSHSKPVSPSDEFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLALSLLSIPAS
SAASERTFSLAGNIITEKRNRIGQQTVDSLLFLNSFYKNFCKLDI