>6ekl_A mol:protein length:211  Mitotic spindle assembly checkpoint protein MAD2B
MTTLTRQDLNSAQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPE
LNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSINSDSLLSH
VEQLLRAFILKISKVDKVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQ
DVHMHDPRLIPLKTMTSDILKMQLYVEERAHKNS