>6f3t_G mol:protein length:94  Transcription initiation factor TFIID subunit 6
KKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKR
QKLTTSDIDYALKLKNVEPLYGFHAQEFIRLRRRA