>6ff7_b mol:protein length:86  Small nuclear ribonucleoprotein F
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHL
GEVLIRCNNVLYIRGVEEEEEDGEMRE