>6ff7_j mol:protein length:92  Small nuclear ribonucleoprotein E
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLD
DAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN