>6g0l_C mol:protein length:130  Histone H2A type 1
MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYL
TAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGRVLPNIQSVLLP
KKTESAKSAKSK