>6gbl_B mol:protein length:336  Parathion hydrolase
ITNSGDRINTVRGPITISEAGFTLMHEHICGSSAGFLRAWPEFFGSRDALAEKAVRGLR
RARAAGVRTIVDVSTFDLGRDVELLAEVSEAADVHIVAATGLWFDPPLSMRLRSVEELT
QFFLREIQYGIEDTGIRAGIIKVATTGKATPFQERVLRAAARASLATGVPVTTHTDASQ
RDGEQQADIFESEGLDPSRVCIGHSDDTDDLDYLTALAARGYLIGLDGIPWSAIGLEDN
ASAAALLGLRSWQTRALLIKALIDQGYADQILVSNDWTFGFSSYVTNIMDVMDRVNPDG
MAFIPLRVIPFLREKGVPDETLETIMVDNPARFLSPTLRAS