>6ge3_L mol:protein length:41  Transcriptional coactivator YAP1
DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE