>6gl7_A mol:protein length:102  Neurturin
ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRL
RRERVRAQPCCRPTAYEDEVSFLDAHSRYHTVHELSARECACV