>6i4x_C mol:protein length:97  Elongin-C
MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVC
MYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC