>6iy3_D mol:protein length:98  Histone H2B
KRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKR
STITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK