>6jod_H mol:protein length:220  Heavy chain of 4A03Fab
DVQLVESGGGLVQPGGSRKLSCAASGFTFSGFGMHWVRQAPEKGLEWVAYISSGSSLIY
YADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYFCATSLYYGTPWFAYWGQGTLVTV
SAAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALL
QSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS