>6k1j_G mol:protein length:146  Histone H2AX
GSHMSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVL
EYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAV
LLPKKTSATVGPKAPSGGKKATQASQEY