>6kc4_E mol:protein length:102  Tyrosine-protein kinase Fer
GSKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQY
VDNMYRFEGTGFSNIPQLIDHHYTTKQVITKKSGVVLLNPIPK