>6kc4_G mol:protein length:102  Tyrosine-protein kinase Fer
GSKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQY
VDNMYRFEGTGFSNIPQLIDHHYTTKQVITKKSGVVLLNPIPK