>6ksf_A mol:protein length:336  Alpha-ketoglutarate-dependent dioxygenase alkB homolog 1
EDAFRKLFRFYRQSRPGTADLGAVIDFSEAHLARSPKPGVPQVVRFPLNVSSVTERDAE
RVGLEPVSKWRAYGLEGYPGFIFIPNPFLPGCQRHWVKQCLKLYSQKPNVSNLDKHMTK
EETQGLWEQSKEVLRSKEVTKRRPRSLLERLRWVTLGYHYNWDSKKYSADHYTPFPSDL
AFLSEQVATACGFQGFQAEAGILNYYRLDSTLGIHVDRCELDHSKPLLSFSFGQSAIFL
LGGLKRDEAPTAMFMHSGDIMVMSGFSRLLNHAVPRVLPHPDGESLPHSLETPLPAVLP
SNSLVEPSSVEDWQVCATYLRTARVNMTVRQVLATGQDFPL