>6l49_E mol:protein length:143  Histone H3-like centromeric protein A
GSHMGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQK
STHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLH
AGRVTLFPKDVQLARRIRGLEEGLG