>6ltj_R mol:protein length:292  Zinc finger protein ubi-d4
MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEK
RHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPGGSGGSGGSYACDICGKR
YKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFC
LGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGT
SENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQNQNSS