>6m6c_E mol:protein length:99  DNA-directed RNA polymerase subunit omega
MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPN
AVTWAMKELLTGRLVFGENLVPEDRLQKEMERLYPVEREE