>6ml4_A mol:protein length:151  Zinc finger and BTB domain-containing protein 24
GPLGSKSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECSHCHRKFMDVSQLKKHLRTHT
GEKPFTCEICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKCFSDSSAKRRHCILHTGKK
PFSCPECGLQFARLDNLKAHLKIHSKEKHTADY