>6muo_F mol:protein length:94  Histone H4
KGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVI
RDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG