>6ncm_B mol:protein length:100  Forkhead box protein N3
GNCKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLN
KCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQALKKTPYHP