>6nzo_S mol:protein length:939  Histone-lysine N-methyltransferase
MEASDRASGPTAGSKSEERTKQNGPRSKKEDASDSSTSTGSKSASRSSSATTMSPDDAK
PADDSALAQENGVAPKPSRKSSKLPPRNPPQLFNHLPDATEEACRTFQVISDCLYGSRN
MGSSDHDALDCDCAEDWRDGKNHACGEDSDCINRATKIECVIGDCNCGEGCQNQRFQRK
QYAKVSVIKTEKKGYGLRADTDLQPNDFIYEYVGEVINEPTFRSRMLKYDKEGIKHFYF
MSLTKNEFVDATKKGNLGRFCNHSCNPNCYVDKWVVGDKLRMGIFAARYIKAGEELVFN
YNVDRYGADPQPCYCGEPNCVGFIGGKTQTERATKLPLATIEALGIEDGDSWDTTVAKK
PRKKKASETDEEYVNSLQPKALDEDGVNKVMATLMQCKEKWIAVKLLSRLQATQDDHLR
HRVVRMHGYQILKSTLNAFKHDNNVVLQVLDILYNLPRITKNKISDSNIEAVVQPLASS
SDERVAFEAKRLLEEWDKLETAYRIPRKKDGRVVSAIANSFEEERRSNREEPTKPADPL
ANVVIPTGPRSNIPQRNANYYNGVRPRKPPTNLPEGWFVTVDKKTGKYYFYDVNGKVQW
QRPTAPAITTPKPSVKAQQDQKALQDIIDSLTKEPTPRQSAGHTPQRSSTPATEPKKEK
WRSLPIEKQMKIYENTLFPHVKYVMDKFHGKLPREDLKKFARDVNKKLVASDYKHNRVQ
DPTVPLSSKQAKKVRKYVYDFFDRALQKYLEYQKRKAQYTSKEGMQSSQTEQNTATPTG
TLGKDVDEVMSDVEAPNSSPQSTSSAGRKRKRDDDQDGDHDMRSPADEDAATSSDPPSV
KRIKEDDGTGNDVIPSPPPPPPPPAEIPMTEEERSMREQEEALMRENEEAQRLEDEAKR
KQLELQNGLAAAKNAGIELGSASFTVSGEPMDVDNDGPPPQEQAQQQKQAVMSH