>6p59_F mol:protein length:220  Virion infectivity factor
MAEKMWIVRPVWRVDRRKIEQWHSLVKYHMYKGKKEAREWEYVPHFKVPWGWWSHSEVH
IPLGNNTKIKVTTYWNLTTEKGWLGTYGAALAYIDQKCDPPYFTDIDPIVADSLIHKIY
FPCFTDKAIRQAILGEKVLLCGFQRGHRDQVGTLQYLAIQAWAREQVKKHGRKSARGPH
WGWRSRVPALVGQNAVRNKSGSQVTLPSRVHFPSLAYLCGTLA