>6p7b_C mol:protein length:149  Holliday junction resolvase
MIICSVDIGIKNPAYAIFNYDNTSNTIKLIAIEKSDWTKNWERSVARDLTRYNPDVVIL
EKQGFKSPNSKIIYFIKGFFYNSNTKVIVRNPTFKGGSYRNRKKQSIDVFIQKISEYTD
YKNDILNKYTKLDDIANSFNLGLSYMESLLK